shell throwing desert eagle leather cover support toy model
Описание
please don't hesitate to contact us if you have any questions or concerns before or after your purchase. we are committed to your 100% satisfaction. choose the right color and size and make sure your address and phone number are correct, if you need packaging, please pay attention or contact our customer service. due to the impact of shooting equipment and light environment, as well as the display of different brands, so the products will have a slight color difference. it's normal range. please
Характеристики
| _GoogleCategoryID: | 1253 |
График изменения цены & курс обмена валют
Пользователи также просматривали
$82.22
New Waltz High End Brand National Standard Dance Dress Lnternational Standard Dance Dress
aliexpress.com
$1,336.26
Thin tube catfish coffee machine Italian fully semi-automatic all-in-one machine coffee machine for household small bean
aliexpress.com
$207.41
Double Cross Zinc Handle Classic Ceramic Diverter Brass Sliding Bar Brass Shower Head Spout Spout Telephone Handset Shower Set
aliexpress.com
$18.05
7Pair/set 25mm Faux 5D Mink Lashes Natural Long False Eyelashes Dramatic Volume Fake Lashes Makeup Extension Eyelash ePacket
aliexpress.com
$2.72
(8 pcs/lot) lovely mixed color 2-11 years children girls panties cartoon thermal underwear for wef11411, Camo
dhgate.com
$141.33
men's jackets loose male baseball uniform, casual cute jacket with a korean trend, and fe blouse for spring fall yaxl, Black;brown
dhgate.com
$18.04
curtain & drapes floral print voile window curtains for living room tulle door drape panel sheer scarf valances 1m*2.7m
dhgate.com
$24.48
belts transparent gauze corset women's fashion simple high waist belt woman waistband lace-up ladies 2021, Black;brown
dhgate.com
$190.23
vipfacemaskmachinediyfacemaskmakerautomaticvegetablefacemasknaturalcollagenfruitfacemaskmachinebeautyfacial raben
dhgate.com
$44.78
350 v2 shoes 3m friday beluga basketball football oreo sneakers static zebra blue tint 2.0 sesame cream turtle casual black moonrock oxford
dhgate.com
$8.80
Wholesale Custom 10 mm Magnet Charm Beads Stretch Bracelet Natural Stone Bead Bracelet for Men and Women
alibaba.com
$3.51
ODM/OEM Collagen Peptide Hyaluronic Acid Gold Hydrogel Super Moisturizing Anti Wrinkle Sleep Mask
alibaba.com
$25.04
Толстовка с капюшоном Slim Fit с карманами, универсальная, подходит ко всему, женская, утепленная, с длинными рукавами, круглым вырезом, цветная, весенняя мода
aliexpress.ru
$19.14
Беспроводной динамик BT5.3 Портативный мини-Bluetooth со встроенным микрофоном IPX4 Водонепроницаемый противоударный уличный рюкзак Велосипедный динамик
aliexpress.ru
$40.03
TEENRAM для Audi 2022/2023 A3/A3L AHD 1080P 150 ° Автомобильная камера переднего вида, ночное видение, рыбий глаз, водонепроницаемые передние камеры автомобиля
aliexpress.ru
